@@waziwazi4952 Araki said he listened to rap music to get into tje "gamgster" mood. He particularly liked Snoop Dog's "Doggystyle" (I'm not making this up)
Truth! Although we started out trying to kidnap Hinata when she was a kid, and stealing jutsus from other villages so we started out with the L for that....even in Naruto we were stereotyped LMAO. didn't realize that before seeing this comment.
So did I, which is why I decided to watch 3-5 like almost a year ago. I feel so weird because this was my song to blow shit up to in GTA 4, but now it’s a jojo reference to me 🧍
A friendly reminder that this is the ending song for a part about a mob boss with multiple personality disorder trying to exterminate his daughter, and a group of sexually confused flamboyant guys protect her
I have friends. They watch jojo. I don't. I love 90's r&b. They don't. I play this song because of my love for 90's r&b. I jam. They jam because its from jojo. And we jam happily ever after. The end.
i love the fact that Araki personally choses these outro songs based on what was impiring him when he was writing that chapter so Ariaki was jamming out to bump and grind music when he was writing golden wind
As a black woman who appreciates her music, I fucking LOST IT here. The creator of JoJo can have ANYTHING HE WANTS. You need money? I GOT YOU You want my social security?? BABY, IT’S YOURS Jesus, I jammed out so hard on this. I love Jojo! 😂👏🏾😅😍
Anyone who’s read Part 5 knows it’s simultaneously the gayest yet manliest thing ever. The juxtaposition between the Opening and Ending perfectly exemplifies this.
ShutInBoy I think it’s weird people are saying that this ending is gay, when it’s literally the most explicit heterosexual sex jam ending. Part 5 though- gay as shit. White Album ending. That is all.
Jimmy Two Times I disagree. Physically manly they are not, but the story is manly as shit. A group of guys fighting against fate and killing fuckers on their quest for glory and money.
I mean, RnB *does* exist in Japan. For example, have you heard of the the musical duo, “SOULHEAD”? If not, I recommend giving them a listen. Songs that I recommend by them are “Secret Love” and “Song for You” to start off. Peace and Love!
You know, the most bizarre thing about this series's outros is that initially you ironically like them for memes, but then you eventually do start to really like them.
Maverick slayer, the theme songs you're hearing are all top charts songs, you're going to like them with repetition, Pop songs no matter the genre have powerful hooks and become popular for a reason
In 10 years or so (My future kids) Giorno and Trish: Hey dad, why did you name us Giorno and Trish? Me: ....Let me take you on....a BIZARRE ADVENTURE....
Same here, and I've been listening to Jodeci for a long time while being a fan of Jojo as well. Its a nice surprise for R&B Fans to learn a new anime and these new Jojo fans to start listening to the passionate music of why Jodeci is a fan favorite.
The creators of this show were either raised Hood or people of culture. They heard this from they mama or just have really good taste and trail of music.
Jojo got me into Jodeci and now they’re one of my favorite artists of all time. One of the few artists I’ve found that I can listen to any album and be vibing to it.
Black anime fans everywhere creamed their pants on Friday night, I'm still getting the stains out Lol. Araki outdid himself here. This choice is probably my favorite, I'm glad he went to R&B as a choice instead of maybe Rock or something. Shows his diverse taste in music and it helps I'm a Jodeci fan.
@@Blurns still its awesome because we love Anime and this is the first Anime with an R&B anything. JoJo's (the singer) Stand should be called All my Life and he can turn people in to love sick Zombies who fight.
Blurns wow you're a grouch lol i was being nice not really rude or anything. Too each their own. I've watched Anime with a plethora of different musci op and endings. Some i like some i dont its not that serious dude.
So... just happened to watch this show on Toonami out of boredom. Was, and still am, in complete shock that they used a Jodeci song. I could only stare, mouth agape, and barely holding the remote when I was gonna change the channel. Now... now this anime has my full attention and I'm watching everything from the beginning.
I'm gonna be real with you A comment section of JoJo memers is far superior to the average old music video comment section. Where no one can spell and everyone's either talking about how new music sucks, a kid talking about how they only listen to old music, or someone calling groups A and B stupid.
Rose-shrouded Confessor then he starts fucking bitches with Jonathan’s body so that means his body cheated on Erina yeah that’s pretty fucked the way I said that
I almost spit out my drink when I first heard these credits roll. “Theres no way theyre playing jodeci for an anime ending” I couldnt have chosen a better anime to do it though lol. Its somehow both hilarious and the most gangster s Ive ever witnessed
@@myaann3470 I’ve been listening to rap music that my parents would play in the car since I was small! Huh, maybe that’s why I’ve wanted to marry a lady since I was 6! 🤣
David production is the goat. They are pushing productions to the next level. Every season, they keep taking risks. I like that. Im tired of all these clones. Bringin fresh air. Good job to them !
When will people learn it’s not going to be the song you want or expect it to be, just because Walk like an Egyptian was a thing. Hell, I was rolling my eyes when people wanted All Star for part 4, just because, hey, 90's. I love this song pick.
@@crisgeraldperez7 Its what people thought would be a sure pick for the ending, because hey, 90's. But because it was "obvious" there was no way it'd happen.
@mc Aka yn Dey ain’t said dey done aired it it jus stopped all of a sudden 4 weeks ago when Abbacchio got killed on Toonami and I’m jus tryna see if y’all kno y dey all of a sudden stoped and when dey re airing
Josuke:AnytimeIneedtoseeyourfaceIjustclosemyeyesandIamtakentoaplacewhereyourcrystalmindsandmagentafeelingstakeupshelterinthebaseofmyspinesweetlikeachicacherrycola Giorno:EVerY tImE I CLoSe mY eYeS I WaKe Up FeElInG sO hOrNY
@@theapexpredator2455 well He cant see how he got hit because The World stops time about the only thing he could do is erase that but he would still start back from before he was hit which is in DIO's time stop.
Josh Bish he can’t predict time that has stopped dio he would just see himself getting impaled by knives or the worlds fist and wouldn’t know how to stop it
When waking up: Jojo Part 1: Jonathan Joestar waking up from his bed normally (I saw it from manga) Jojo Part 2: AYAYAYAY Jojo Part 3: Kakyoin waking up having a nightmare from Death 13 Jojo Part 4: MORI MORI MORI MORI MORIOH CHO RADIOOOO Jojo Part 5: Horny
A kid with a dream that’s also Jesus, a mom, a former cop, a guy with 6 kids, a little boy with a plane, some Swiss cheese, and a little girl wearing clothes that no child/teen should wear team up to stop Funtime Freddy. I described part 5.
![The Pillar Men Awaken - Full Scene [HD]](http://i.ytimg.com/vi/LwsIHG-vLOQ/mqdefault.jpg)
Дуже цікава пісня💀
Exactly
“ freak you “
🤣
Spy stick finger stick
Я в такому шоці був, коли її почув)
Де де, але точно не тут таке я очікував почути
Now even the morning wood is a jojo reference
German science at it’s finest
*STANDO*
AWAKEN MY PP!
Von Stroheim BRAAAKAA MONOGAAAAAA
( ͡° ͜ʖ ͡°)
Having a song about sex as the ending for an anime where the vast majority of characters are muscular dudes in flamboyant outfits.
Ha.
This is perfect
And underaged at least where I’m at
You ant from the hood this shit bang
It’s even better after you watch the interview where Araki says he’s ashamed for JoJo being so gay.
Remember guys, Araki chooses the ending songs. What a legend.
Glad it's this instead of gangster rap
He must have got some the night before 😂
you'll think it was some gangsta beat or sicilian rustic mandolin stuff
but Araki/DP said
B I Z A R R E and F A B
@@waziwazi4952
Bro Big Bur Nah or something like "Dre-Day" from Dr.Dre or a Eazy or Cube song, would have been totally sick
Wdym "atleast it’s not"
@@waziwazi4952 Araki said he listened to rap music to get into tje "gamgster" mood. He particularly liked Snoop Dog's "Doggystyle" (I'm not making this up)
The black anime community aint had a W like this since the reveal of the Cloud Village 😂😂
Facts
LOL.😂 😂😂
Truth! Although we started out trying to kidnap Hinata when she was a kid, and stealing jutsus from other villages so we started out with the L for that....even in Naruto we were stereotyped LMAO. didn't realize that before seeing this comment.
No we ain’t had a w like this since luffy had a black transformation gear 4
Forreal
When this was leaked I did not believe it because I couldn't see "I feel so HOOOORRNY!" in a jojo ending.
But here I am, in total shock
Afksgsh fucking same
and Sticky Fingers is a walking dick joke
Seeing all these sexual poses and hearing these sexual lyrics with Trish, a 15 year old girl being the centre stage is a bit concerning.
Who's looking at Trish when Mista is posing like that
You're right, Mista and Narancia are clearly the sexist people here
I thought this was a meme wtf
THIS IS REAL
There is no memes in Gangstar world
So did I, which is why I decided to watch 3-5 like almost a year ago. I feel so weird because this was my song to blow shit up to in GTA 4, but now it’s a jojo reference to me 🧍
I thought i had problems with hearing but no... This is real :')
samee
This is how I started watching Jojo 😆😆
A friendly reminder that this is the ending song for a part about a mob boss with multiple personality disorder trying to exterminate his daughter, and a group of sexually confused flamboyant guys protect her
You deserve it
But they pulled a fucking banger so I ain't complaining
where they protect her from a group which may or may not have a Italian pineapple mammoni
It's fits perfectly
They’re not sexually confused, they’re just European.
I have friends. They watch jojo. I don't. I love 90's r&b. They don't. I play this song because of my love for 90's r&b. I jam. They jam because its from jojo. And we jam happily ever after. The end.
@Guido Mista oh boy cant wait for your comment to go 4 Days ago
@Guido Mista the reply button has been touched by killer queen
Guido Mista are you sure
@Guido Mista 4
@Guido Mista i need 4 cents
Thisnis the song DIO listened to while he muda'd Giorno's mom
This song was from 1995, Giorno was born in 1986
Lol
@@Sneedboy DIO found a way
@@Sneedboy Diavolo helped him out
@@JoelGarcia-lu3tw he banged at the rhythm of Holy Diver
it's not gangster paradise but i'm not disappointed
why huh?
there was a 0.1% chance it'd be the song most people expected it'd be.
Ill give em this it is bizarre and appropriate
if you're not disappointed, then you're appointed.
Zipper man
It’s not gay, it’s homoerotic
Homoerotic in Jojo = being gay while being fabulous
We all know Caesar and Joseph did this
@@compatriot852 czcams.com/video/NGhqGbRNBz4/video.html
czcams.com/video/vQrhWsBmMQw/video.html Look this!
👁️👄👁️
tell that to yukio mishima
its just a nice song
i love the fact that Araki personally choses these outro songs based on what was impiring him when he was writing that chapter
so Ariaki was jamming out to bump and grind music when he was writing golden wind
it all makes sense now
Suddenly a lot of things make sense….
I WAS ALWAYS WONDERING ABOUT THIS, THIS IS AMAZING
Makes sense
LOL MY PARENTS ACTUALLY KNOW THIS SONG, WHEN I PLAYED IT ON MY PHONE THEY WERE LIKE “YOOO THATS FREEK’N YOU!!!”
HAHA SAME
Funny how my own mother doesn't know this song considering I WAS BORN IN 1995! (the year this song's album came out)
Bro I think this is the song they conceived you to
I think it’s the new roundabout lol I think both songs were in gta lol
Damn this comment made me feel old as fuck cuz I grew up listening to this shit with my parents lmfao, I was 8 when this song came out 😂😂😂
Ill be real with you shinzo abe,
This will not fix japans declining birthrate
Araki was probably like "Hey, it was worth a shot." LMAO!
Japanese man: wife my boner is up
Japanese woman: thank you Jojo
Well someone had to do something =/
Thank you, Gyro*
I'm not sorry.
😂
I think purple haze has the best pose in this ED
But, I think Abbacchio is better
kyleaca cus that’s purple haze
Before feedback
I came to look at it after Alucard said "and before you ask, yes this is a jojo reference" in Helsing Abridged
Actually they all are
I like Mista’s
As a black woman who appreciates her music, I fucking LOST IT here.
The creator of JoJo can have ANYTHING HE WANTS.
You need money?
I GOT YOU
You want my social security??
BABY, IT’S YOURS
Jesus, I jammed out so hard on this. I love Jojo! 😂👏🏾😅😍
Thank you
Loved it! Caught off guard but I respect the anime more.😊😊
IT MAKES ME SO HAPPY SEEING OTHER BLACK WOMEN INTO JOJO! ESPECIALLY W US GROWING UP WITH THIS TYPE OF MUSIC
@@Arrahss there should be a group of us I know a few black women that like anime
Lol I was roundhouse kicked in the chest with the amount of nostalgia
Anyone who’s read Part 5 knows it’s simultaneously the gayest yet manliest thing ever. The juxtaposition between the Opening and Ending perfectly exemplifies this.
ShutInBoy I think it’s weird people are saying that this ending is gay, when it’s literally the most explicit heterosexual sex jam ending.
Part 5 though- gay as shit. White Album ending. That is all.
there is literally nothing manly about part 5, the manliness ends after part 3
Jimmy Two Times I disagree. Physically manly they are not, but the story is manly as shit. A group of guys fighting against fate and killing fuckers on their quest for glory and money.
@@jimmytwotimes2003 part 5 boys gets mutilated, toss around and gets toss around, sacrifice and seemingly doesn't whine about being in pain....
It's also like the most violent, brutal part
This song perfectly describes me when I see Jotaro.
@Seraphi Grimaldi We're obviously talking about part 6 Jotaro here
Hes in his 30's here
He's 31 isnt he? Part 4 he was 28.
Seraphi Grimaldi part 4 Jotaro is better than part 3 Jotaro.
I thought he was talking about Alessi'd Jotaro...
Disappointed.
Anime needs more R&B.
EVERYTHING NEEDS MORE R&B!
Sol Maq I mean there’s a ton of romance and harem anime
SuperFusionAJ93 facts on facts
I mean, RnB *does* exist in Japan. For example, have you heard of the the musical duo, “SOULHEAD”? If not, I recommend giving them a listen. Songs that I recommend by them are “Secret Love” and “Song for You” to start off. Peace and Love!
Faaacts
Don’t care what people say this is the best ending song
I like this ED and the Oingo Boingo brothers ED equally
indeed!!!
And roundabout
besides roundabout ye
@@snuk3655 nah
Wanted Gangster's Paradise, didn't expect this
not disappointed
Aaron why do I keep seeing this comment?
Is that the song it was supposed to be?
Interesting fact: theres a clip of Notorious BIG singing the beginning of this song. fact:czcams.com/video/TYLQjDjqKrc/video.html
I think it just became a meme for a while. Ever since Part 4's anime ended everyone wanted the unannounced Part 5's ED to be Gangster's Paradise.
@@aaron9818 yeah true but alot of people got really pissed because it wasn't gangsta paradise and started in quote "fixing it"
@@xblade149 people should've learned by now that it's never the song that they want. They get it wrong every time.
Araki down for the culture
You know, the most bizarre thing about this series's outros is that initially you ironically like them for memes, but then you eventually do start to really like them.
MrMustache lol dawg this is a classic song from the 90s
Lmao ur right tho
Agreed, memes aside it's a good song lol
Maverick slayer, the theme songs you're hearing are all top charts songs, you're going to like them with repetition,
Pop songs no matter the genre have powerful hooks and become popular for a reason
If anyone sees this i played this at 12:00 at 2020 so happy new year bois
Happy New Year
Happy new year ♥️
KosdiD Happy New Year!
@@Salemwaaa thanks, you too~
I think about freakin you
It's gonna be kids named Bruno and Giorno with neglectful weeb parents in about 2 years.
Looool
😂😂😂😂
Girls finna be called Narancia
I’m naming my son Giorno Giovanna when I have one, real talk lmfao
In 10 years or so
(My future kids) Giorno and Trish: Hey dad, why did you name us Giorno and Trish?
Me: ....Let me take you on....a BIZARRE ADVENTURE....
Yo, gangster Paradise sure Souds weird
I still think Damn It Feels Good To Be A Gangsta would have been a better choice.
same
Should of been "The Next Episode"
turn the speed of this vid to 1.25 and play gangsters paradise in another tab, i think it fits fairly well
this is my alarm now
Wake up feeling so HOOOO-
Mine is aayayayayeeeee
Abrar Rossi I can confirm this
I've used this alarm for almost 2 years
Wow, congrats. Your comment is pinned
"This sounds too seductive for any standard anime."
-Etika, may his soul rest in peace
I can't believe Jodeci is an ending theme for Vento Aureo.
God DAMN, Araki and David Productions has some damn good taste.
I fucking lost it when I heard this, It was a nice surprise
Same here, and I've been listening to Jodeci for a long time while being a fan of Jojo as well.
Its a nice surprise for R&B Fans to learn a new anime and these new Jojo fans to start listening to the passionate music of why Jodeci is a fan favorite.
@@LuffyBlack me to!!
@@LuffyBlack I was like, yasss they getting it!
The creators of this show were either raised Hood or people of culture. They heard this from they mama or just have really good taste and trail of music.
This credits sequence is such a early 2000's aesthetic, I love this
@Hassan Glaster setting take place in '01
Where all my black people who grew up on Jodeci and are Jojo fans ?
not me
Jojo got me into Jodeci and now they’re one of my favorite artists of all time. One of the few artists I’ve found that I can listen to any album and be vibing to it.
U a real one not gone lie
Jodeci, next JoJo confirmed
✊🏿
Illuso: *dies in a brutally way*
The ending:
Is it normal to be amazed by the poses? I mean, I've read all up tp JoJolion but still amazed...
Evilsizer narancia is literally Michael Jackson
It's not normal not to.
Fun fact: this song , prince's gold experience album and the golden wind manga are released in 1995.
fransuke12 Heh. Nice
Yet another W for the black anime community
Why do people keep saying this!? No segregating the anime community!
@@mistermadness677 it’s just apart of our culture, no one is segregating it
0:05 WOW, THAT IS RELATABLE
I m hearing this in School
Kuwa?
Good song btw
It's a good song👌
@@Sparngl indeed
Same lol all my classmates crowded around my desk laughing
*character dies brutally*
the ending:
Fr
doing the dirty is now a jojo's reference
Mona Lisa:
Kira: 0:00
Holly
Kakyoin: 00:00
@@iamrocker6619 Holly*
Lisa Lisa:
Joseph: 00:00
Dolphin:
Jotaro: 0:00
Yasuho
Joshu: 0:00
Black anime fans everywhere creamed their pants on Friday night, I'm still getting the stains out Lol. Araki outdid himself here. This choice is probably my favorite, I'm glad he went to R&B as a choice instead of maybe Rock or something. Shows his diverse taste in music and it helps I'm a Jodeci fan.
I don't think Araki chose it.
@@Blurns still its awesome because we love Anime and this is the first Anime with an R&B anything. JoJo's (the singer) Stand should be called All my Life and he can turn people in to love sick Zombies who fight.
I don't really care for the song or R&B in general, but I find it funny. I also don't want to hear your shitty stand idea.
for real it was so cool to see this as a old r&b fan and a black anime fan this was amazing 😊😊😍
Blurns wow you're a grouch lol i was being nice not really rude or anything. Too each their own. I've watched Anime with a plethora of different musci op and endings. Some i like some i dont its not that serious dude.
So... just happened to watch this show on Toonami out of boredom. Was, and still am, in complete shock that they used a Jodeci song. I could only stare, mouth agape, and barely holding the remote when I was gonna change the channel. Now... now this anime has my full attention and I'm watching everything from the beginning.
Good choice
What did you think?
Eveytime I close my eyes😭
I WAKE UP FEELING SO HOOOORRRNNNYYYY!
@@Fugo_Pannacotta880PWHAHA
Mista’s pose is the zestiest of them all😂
No, Brunos was🤣🤣
Purple Haze Beats em all
DO YOU SEE ABBACHIO THAT POSE IS NOT PHYSICALLY POSSIBLE
na giorno is the most sus one, man was almost grabbing up his own stand
The song is sung by JOdeci lol
David Production is amazing
lead singer's name is actually Jojo. I'm not kidding
@@tonberry2670 I know right.
@@tonberry2670 interesting fact:czcams.com/video/TYLQjDjqKrc/video.html notorious big actually sang a little bit of this song.
Warner bros picked the song actually, which might be why it's weird as fuck.
JoJodeci
Bring your girl back to my place and give her that Golden Experience 😎
leaving me with Sticky Fingers
💀
THERES NO WAY THEY PUT THIS AS THE ACTUAL ED😭😭😭
THATS WHAT IM SAYING
I said the same thing
Go to the original Music Video.
To see how us fans destroy a goddamn comment section.
Thats why i hate fandoms sometimes
Go to the Gangsta's Paradise Video
It's even better
1000 Hit Combo no tucking mercy
@@xblade149please, don't hate jojo's fandom.
I'm gonna be real with you
A comment section of JoJo memers is far superior to the average old music video comment section. Where no one can spell and everyone's either talking about how new music sucks, a kid talking about how they only listen to old music, or someone calling groups A and B stupid.
Nobody:
Dio to Jonathan: 0:30
Jonathan: Every time I close my eyes...
*DIO: I WAKE FEELING SO HOOOOORRRRNNNNNYYYY*
*_*Takes Jonathan's body and starts Part 3*_*
Rose-shrouded Confessor then he starts fucking bitches with Jonathan’s body so that means his body cheated on Erina yeah that’s pretty fucked the way I said that
Remember when DIO was _really_ feeling Jonathan's body during his monologues?
Oh god! Please no!
No he started part 5
When Dio jacks off, he's giving Jonathan a handjob
I almost spit out my drink when I first heard these credits roll. “Theres no way theyre playing jodeci for an anime ending” I couldnt have chosen a better anime to do it though lol. Its somehow both hilarious and the most gangster s Ive ever witnessed
I heard this song at so many of my family cook outs it's insane that it's in my all time favorite series
At the cookouts? Not Frankie Beverly and maze? So sexual for family reunions lmaoo
@@myaann3470 uncle gotta get rhythm from somewhere 😏 (kill me)
@@myaann3470 I’ve been listening to rap music that my parents would play in the car since I was small!
Huh, maybe that’s why I’ve wanted to marry a lady since I was 6! 🤣
Life was good when Golden Wind aired.
My mom listens to this song
That's toit
your mom :I play this when I was with your dad
and this how you coming to the world
it's joke
I bet Jotaro is playing this music while "Studying Dolphins" 😂
I still think about how goated JoJo is for using a Jodeci song on the outro 😭 it's too perfect
Between this and Roundabout, I guess I need to finally give JoJo a chance.
Please do it is the best anime periodt.
Wish I could relive the surprise I felt hearing this for the first time 😪
David production is the goat. They are pushing productions to the next level. Every season, they keep taking risks. I like that. Im tired of all these clones. Bringin fresh air. Good job to them !
Araki choose this songs
When will people learn it’s not going to be the song you want or expect it to be, just because Walk like an Egyptian was a thing. Hell, I was rolling my eyes when people wanted All Star for part 4, just because, hey, 90's. I love this song pick.
IKR? Gansters paradise would be way too obvious. It would be like wanting holy diver for Part 2 of Stardust Crusaders. I'm glad this was their choice.
Exactly. Hell the second ending for stardust crusader was different.
Shock Vox All Star for Part 4 ED? I didn't even think about that.
@@crisgeraldperez7 Its what people thought would be a sure pick for the ending, because hey, 90's. But because it was "obvious" there was no way it'd happen.
So that means I should give up on the idea of Ocean Man for part 6?
Jojo getting freaky
Me watching part 4 ed:
The lyric of the ending sound a bit hmm.. Well why would they even-
Jojo ed 6:
Me: 👁👄👁 hol- up
EVERY TIME I CLOSE MY EYES
But doe anybody knows y dey stop airing da series
@@diamondwilliams3215 wait what? O_O)?
@mc Aka yn Dey ain’t said dey done aired it it jus stopped all of a sudden 4 weeks ago when Abbacchio got killed on Toonami and I’m jus tryna see if y’all kno y dey all of a sudden stoped and when dey re airing
@@diamondwilliams3215 no dey didn stop airin it in da middle of da story men, dey aired da series till' da end men, if dat what're ya talkin' bout
Ah I remember watching this when my mom was near me and when she heard it she just stared at me like WTF
XD
Mista: Yo, Giorno, I’m literally dying. Heal me please.
Giorno:
My Mom : Son , you don't know real music
Me :
My Mom : oh my god son , you okay?
So how'd it go with your mom?
I do not know ┐( ∵ )┌
giorno: is the youngest jojo protag
david pro: makes this the ending
Josuke:AnytimeIneedtoseeyourfaceIjustclosemyeyesandIamtakentoaplacewhereyourcrystalmindsandmagentafeelingstakeupshelterinthebaseofmyspinesweetlikeachicacherrycola
Giorno:EVerY tImE I CLoSe mY eYeS I WaKe Up FeElInG sO hOrNY
love how this ending after scene with giorno healing mista
Araki be playin too damn much 😂
I wasn't expecting this to happen..
never would i have thought id hear jodeci in an anime lmao
This question is for jojo fans do u think that dio can beat diavolo
@Narancia Pudding yeah but diavolo would predict that and the worse case scenario is that he uses king crimson to pre block
King Crimson can only see into the future however he would only see what Dio did to him not how he did it to him.
@@nemisous83 so ur saying that diavolo will be clueless on how he got hit
@@theapexpredator2455 well He cant see how he got hit because The World stops time about the only thing he could do is erase that but he would still start back from before he was hit which is in DIO's time stop.
Josh Bish he can’t predict time that has stopped dio he would just see himself getting impaled by knives or the worlds fist and wouldn’t know how to stop it
When waking up:
Jojo Part 1: Jonathan Joestar waking up from his bed normally (I saw it from manga)
Jojo Part 2: AYAYAYAY
Jojo Part 3: Kakyoin waking up having a nightmare from Death 13
Jojo Part 4: MORI MORI MORI MORI MORIOH CHO RADIOOOO
Jojo Part 5: Horny
That’s a good one 😂
JoJo's community 🤝 Black Community
Vibing to Freek'n You 🙏
Ending episode: abbachi gets murdered brutally
The outro song:
i can't even be mad that it's not gangsters paradise when they playing jodeci, especially since one of the members name is jojo
it puts the "fabulous" thing in the anime
This was set in a time era where this song was #1 in the charts so they added to the ending credits : GENIUS 💯
* Diovolo dies sad and alone *
* This plays *
"Bossu...please...call me...like you always...have..."
" *EVERYTIME I CLOSE MY EYES I WAKE UP FEELING SO 𝓗𝓞𝓡𝓝𝓨* "
*character dies*
ending: Everytime i close my eyes wake up feeling so hor-
the colors mixed with the still poses and jodeci playing in background, this is without a doubt the GOAT of ending credits in all of television…
....Certified Anasui mood with Jolene
Jolyne when the moon exists:
*Character dies*
Ending: 🥴😈
Hahahah
I thought I was tripping wtf lol this is fire 😂
My partner is a successful producer in west coast rap and I’m tryna convince him to sample this song
everytime i close my eyes....
I WAKE UP FEELIN SOOOOOOOOOO HORNYYYY
@@NuggetMilitia1I CAMT GET YOU OUTTA MY MINDDD
A kid with a dream that’s also Jesus, a mom, a former cop, a guy with 6 kids, a little boy with a plane, some Swiss cheese, and a little girl wearing clothes that no child/teen should wear team up to stop Funtime Freddy.
I described part 5.
When a 15 year old kills more people in the span of a week than the average hitman in a year
I like how moody blues pose is like "oh no this happening again"
This is the best anime ending ever
Jo Jo is now the GOAT Anime for this, don’t at me
I am officially a gangster
No, Gang-Star
A GANGSTER STAR!!!
They cultured and goated for this
😂👌🏽💯
This song reminds me of bruno bucciarati
The fact when you think your Spotify started playing and you realize it’s the ACTUAL ENDING SONG. LEGENDARYYYYY
this shit makes the lightskin of me come out
Character: *dies brutally*
Outro 0.3 seconds after:
People in the anime: Die in the most gruesome ways
The ending: *EveRY tIMe I cLOsE MY EyeS*