I would like to see a detailed break down of what lead to the placement of each of the top 6 horses placed in the competition. I think it would be interesting if breed shows would post the their score cards in each area used to place each horse! What do you think? Take some of the who's who's out of competition
(1:31) Just As Predicted. wOW. He looks like his daddy (Brooks or Dun). I thought he was the best of the group. Tough (with a Capital "T") competition. Thank u for sharing!!!
Also, can someone let me know what APHA stands for too please! Knowing that will probably answer my previous questions listed below. Hello America from the not so sunny UK :-)
I live in the uk and i dont recognise the breed of all these yearlings, could someone tell me?? They all look so different to most horses i see in the uk. Their quarters are huge with muscles yet finer at the shoulder, virtually no withers, a flat back and when they walk they all look very stiff. Is this typical of the breed? A
They are Paints. Similar to Quarter Horses (also bred in the USA) but with white markings. Quarter horses, Paints, and Appaloosas are all much more muscular than Thoroughbreds and Arabians, but they are not all like these yearlings. These yearlings were bred to be "halter" horses, meaning they are shown for their bodies and appearance rather than their ability to perform. Think of it as a muscle man or body builder competition for horses. They are kept in the barn and fed a lot of high-protein grain so they build a ton of muscle which looks good, but it makes them walk stiff like you noticed and they are often poor performance horses. Quarter horses and Paints that are bred for performance (riding) are usually lighter muscled, look quite a bit different, and move much more effortlessly than halter horses.
+lucy5471 the USA is breeding for deformed looking horses. Lots of these are Impressive bred horses, and like you said, they look ridiculous. And many have muscle problems.
Unfortunately, this is normal for the stock type halter division---lead and feed---the majority of these babies will never be able to be ridden or do anything else besides halter.
They have really run the breed into the ground! I love halter horses, raised them for many years, had a ton of winners, and the US has to go so overboard on EVERYTHING! If many take a good look, most halter horses don't live long lives! Probably a good thing though, show lives normally suck! The horses are locked up constantly and not allowed to be a horse
Oh gosh, besides the terrible confirmation and weight issues, why is this lip chain thing so popular these days? It’s so dumb and the horses are usually really flinchy and fussy/reactive to them. Why can’t they be easy to handle with just a regular lead or chain under the chin even like they used to do without problems? I just don’t get it at all.
This is disgusting. How can anyone think this looks okay? I thought the reason for halter classes was to showcase the top quality horses of the breed who are made to succeed in shows and at the farm. To show a good example of the breed and how the ideal look. Take any of these horses and they wouldn't last a week! They're bred for nothing else than to stand there and look pretty, and they even fail at that! These horses look deformed and it makes me seriously consider where humans have gone wrong to allow this to even be a thing!
We have animal welfare for underweight horses, but not obese ones. Americans love the look of an obese horse. Many people here think an overweight horse is healthy, and a healthy one is underfed.
The coloring looks so unnatural and they all have the exact same gait and confirmation. Almost as if they are clones with variations in the color placement. Very weird......
The colors are natural for a paint. However the frame overo carries a genetic faulty gene called lethal white syndrome. It's the bodies under the hide that's a mess.
those are some of the ugliest, most painful-looking gaits I've ever seen on horses. if I saw a horse at my barn walking like that I'd be calling a vet! I can't even tell if it's lameness or just how damn overmuscled they are that it restricts their range of movement. it looks horrid at best and is actually painful for the horse at worst. at least a couple are definitely lame.
Some of it is the breeding. Impressive horses tend to have bad legs. Some have front legs that at the knee they *rock and shake* then sometimes the ankles rock and pop over the hoof. Laminitis and other leg issues run rampant in these horses.
That 5th place horse had some of the worst withers on a horse I've seen. I'm sorry but these are some of the ugliest horses.....huge heads on some of them, horrible legs on others and the ones withers. Paints the longer they breed them the junkier they get.
My word...these yearlings DO NOT LOOK LIKE YEARLINGS! Looks like they have been on steroids.
DdAASDFSAAEYHDAWRDAARJGSARFAAQRGDAAQEGBDAAQRHGAAEYYDARGFSAQRTSSYHDAAQTUJDAQTYDAAETDAAQEYHDAWTFSAQRFAWRQWWWTUOO122!SSDSSAWSASDDSFDSRYRDYU💰💰💲💰💰💰💰💰💰💰💰💰💰💰💰💰💰💰💰🐎SWAWETGGFSAEYIJGDAQQEGHGFSAETTDAQTGGFSAAWYTAATYSARTWATPYYGDSDGGSTUGSSRYEARUYRWERSARYUESSTSSSRYUIJQQQWQERW@ QW ✈SWWWRTDAQQQWSAET@ QW 🐎QQWR2221256656775@AASFDASTUIOJYDAAWYYYYDAEYYEQTWEUTRT UTYTSYUEFEQWEQERYYSAEYUIURW
They are stunning!!💞💞💞💗💕💕
Hard to believe these are yearlings. Good grief.
All those horse s are absolutely beautiful
the liver chestnut with white on his belly is lame on his back leg. What are the judges thinking.
They sure do not look like yearlings :(
I would like to see a detailed break down of what lead to the placement of each of the top 6 horses placed in the competition. I think it would be interesting if breed shows would post the their score cards in each area used to place each horse! What do you think? Take some of the who's who's out of competition
Beautiful Horses just gorgeous!
It sure is!
What the What? Why do more half of them appear lame in at least one front leg? Poor babies.
because they most likely are. Many halter horses have horrible front legs. It comes out of impressive.
Una consulta.
El caballo Pinto es el mismo cuarto de milla pero con manchas.!!?
It is hard to believe these a yearlings. Poor things. Shame on the breeders and owners.
(1:31) Just As Predicted. wOW. He looks like his daddy (Brooks or Dun).
I thought he was the best of the group. Tough (with a Capital "T") competition.
Thank u for sharing!!!
How beautiful!!
This is crazy!
Also, can someone let me know what APHA stands for too please! Knowing that will probably answer my previous questions listed below. Hello America from the not so sunny UK :-)
It stands for American Paint Horse Association
que lindo cavalo é esse
Wow those horses sure don't look like yearlings
I live in the uk and i dont recognise the breed of all these yearlings, could someone tell me?? They all look so different to most horses i see in the uk. Their quarters are huge with muscles yet finer at the shoulder, virtually no withers, a flat back and when they walk they all look very stiff. Is this typical of the breed? A
They are Paints. Similar to Quarter Horses (also bred in the USA) but with white markings. Quarter horses, Paints, and Appaloosas are all much more muscular than Thoroughbreds and Arabians, but they are not all like these yearlings. These yearlings were bred to be "halter" horses, meaning they are shown for their bodies and appearance rather than their ability to perform. Think of it as a muscle man or body builder competition for horses. They are kept in the barn and fed a lot of high-protein grain so they build a ton of muscle which looks good, but it makes them walk stiff like you noticed and they are often poor performance horses. Quarter horses and Paints that are bred for performance (riding) are usually lighter muscled, look quite a bit different, and move much more effortlessly than halter horses.
+lucy5471 the USA is breeding for deformed looking horses. Lots of these are Impressive bred horses, and like you said, they look ridiculous. And many have muscle problems.
Unfortunately, this is normal for the stock type halter division---lead and feed---the majority of these babies will never be able to be ridden or do anything else besides halter.
e muito bonito
They have really run the breed into the ground! I love halter horses, raised them for many years, had a ton of winners, and the US has to go so overboard on EVERYTHING! If many take a good look, most halter horses don't live long lives! Probably a good thing though, show lives normally suck! The horses are locked up constantly and not allowed to be a horse
Yes many of them are dead before 10 from founder and other leg issues. Not to mention hypp.
the roan is very lame aswell, disgusting. Its probably a guise to breed for meat, later.
bonitos caballoa
Tutti esperti.....di catenelle in bocca! Possibile che sia cosi' difficile condurre un cavallo a mano?
There's paint horses " then " there's these beauties WOW .
Nothing beautiful about this breeding...bad necks, bad legs, bad withers, over muscled. These horses are useless.
Oh gosh, besides the terrible confirmation and weight issues, why is this lip chain thing so popular these days? It’s so dumb and the horses are usually really flinchy and fussy/reactive to them. Why can’t they be easy to handle with just a regular lead or chain under the chin even like they used to do without problems? I just don’t get it at all.
why do u think he didn't win his lame on his back right leg
This is disgusting. How can anyone think this looks okay?
I thought the reason for halter classes was to showcase the top quality horses of the breed who are made to succeed in shows and at the farm. To show a good example of the breed and how the ideal look.
Take any of these horses and they wouldn't last a week! They're bred for nothing else than to stand there and look pretty, and they even fail at that!
These horses look deformed and it makes me seriously consider where humans have gone wrong to allow this to even be a thing!
terrible , is there no end to the idiocy , force feeding these poor animals, is there no animal welfare in the us?
We have animal welfare for underweight horses, but not obese ones. Americans love the look of an obese horse. Many people here think an overweight horse is healthy, and a healthy one is underfed.
You won’t see these horses in the ring at six years of age, they will be broke down by then. Sad.
The coloring looks so unnatural and they all have the exact same gait and confirmation. Almost as if they are clones with variations in the color placement. Very weird......
The colors are natural for a paint. However the frame overo carries a genetic faulty gene called lethal white syndrome. It's the bodies under the hide that's a mess.
Horse abuse! nothing more to say
I agree with you. Horse breeders do they really love horses? I don't think so. Poor horses😢
those are some of the ugliest, most painful-looking gaits I've ever seen on horses. if I saw a horse at my barn walking like that I'd be calling a vet! I can't even tell if it's lameness or just how damn overmuscled they are that it restricts their range of movement. it looks horrid at best and is actually painful for the horse at worst. at least a couple are definitely lame.
Some of it is the breeding. Impressive horses tend to have bad legs. Some have front legs that at the knee they *rock and shake* then sometimes the ankles rock and pop over the hoof. Laminitis and other leg issues run rampant in these horses.
That 5th place horse had some of the worst withers on a horse I've seen. I'm sorry but these are some of the ugliest horses.....huge heads on some of them, horrible legs on others and the ones withers. Paints the longer they breed them the junkier they get.
So overweight!