Oh Madhumitha | Episode 3 | Latest Telugu Web series 2024 | Ft
Vložit
- čas přidán 9. 07. 2024
- #trending
Oh Madhumitha | Latest Telugu Web series 2024 | Ft @mamthanarayan
►Do Subscribe to my Channel
@mamthanarayan
Starring
Mamtha Narayan
/ mamtha_narayan1
Harshavardhan
/ u_can_call_me_harsha
Balu Mahendra, Bhanu Prakash
Cinematographer: Bhanu Prakash
/ bhanuprakhash
Writer & Director : Balu Mahendra
/ i_balumahendra_official
Producer : Mamtha Narayan
Editing, SFX, Designs & Grading :
Nikhil Jogi
/ nikhiljoginikhil
Music Tracks:
Nikhil Jogi, Vasanth, Terish
Sound Engineer : Shravan Kumar
© All Rights Reserved
#webseries #film #madhumitha #savari #aradhya #filmmaking #vayyaribhama #parichayam #taara #subbalakshmi #kwc #filmmaker #filmfestival #director #cinema #indiefilm #cinematography #movie #actor #shortfilms #movies #art #filmmakers #filmproduction #shortfilmfestival #photography #cinematographer #films #behindthescenes #actress #video #independentfilm #love #animation #producer #acting #actorslife #festival - Zábava
Episodes మధ్యలో ఇంత గ్యాపా?
thank you for watching.. gap vachina gap lekunda fun isthunam kada
She act serials also gap comn
Ammayi garu serial lo act chesthu, malli web series chesthunnaru, congrats🎉🎉🎉 for that mamatha akka.
ఇదేం ట్విస్ట్ ట్విస్టు రా బాబు మైండ్ బ్లోయింగ్
Baalu gaaru & mamtha so nice pair really.. ending twist maatram balea undi.. eagerly waiting for next episodes .. all the best fr all of ur Team
thankyou for watching andi.. . pls share video with your friends too..
బావుంది మమత
Thanks for watching
Good job 👌👏 amazing 😍 nice 👍
Thank you for watching
Excellent acting by both...
thanks for watching andi
Bagundi, waiting for next
thankyou for watching andi.. content baga ravali ante gap ravatam normal. pls share video with your friends too..
🥰🥰🥰amazing
thank you for watching..
Nice andi Mamatha garu👌nenu me subscriber ..... Meru chesina prati okka video naku chala nachutundhi 😍❤️.....nice story , nice screen play , nice bgms everything i loved it. And suspense kuda bagundhi next em jaragabotundhi anna tension ey maku ekkuva aipotundhi 😂
thankyou for watching andi.. pls share video with your friends too..
mamata acting super
thankyou for watching
Full comedy 😂and superb
thanks for watcing
Superb episode. ..but again too late to upload
Thankyou for watching.. content mukyam apudapudu late avthundi bro
Eagerly Waiting for next episode
thankyou for watching andi.. content baga ravali ante gap ravatam normal. pls share video with your friends too..
Super Mamata ji
share with your friends ji. tell them to subscribe
Chala bagundi mamtha
subscribe chesi mar muguriki subscribe cheyamani chepandi..
Nice episode❤❤❤
Thanks for watching
Nice 👌
thankyou
for watching
❤❤❤
thank you for watching..
This sequence is doing quite interesting one and another, you people are giving the best even if you interlude.
Thanks for watching
Good 😮
THANKYOU FOR WATCHING
Video chala bagudi bro next video petadi bro pless
thankyou for watching andi.. content baga ravali ante gap ravatam normal. pls share video with your friends too.. subscribe chyandi bro
Mamata gaaru action super 🎉im big fan
Thank you for watching
Hello mayitadiogue expeodulation is super❤🎉
merci d'avoir regardé les vieux, abonnez-vous thankyou
Super madam me acting me smile all superb
thankyou for watching andi.. pls share video with your friends too..
Twist bagundi
Thank you
Nice
thankyou for watching andi.. pls share video with your friends too..
O madu mitha your action wav madumitha annattu vundi❤
edo chepataniki try chesinatu undi. anyhow thanks for watching
Waiting 4 th episode
Sure will give you the best content from the next episode.. thank you for watching
Iam waiting for next episode 😂
thankyou for watching andi.. content baga ravali ante gap ravatam normal. pls share video with your friends too..
Superb episodes andi
..but konchem soon ga upload chesthey baguntundhi ...
thankyou for watching andi.. content baga ravali ante gap ravatam normal. pls share video with your friends too..
The episode is so superb ante twist not only for him here for us also
thankyou for watching andi.. pls share video with your friends too..
@@BaluMahenderapeuryiryyeyoyreyqwuprypyyyyytqitewyvqprypyiqyrpryyeqpqqpiyqpzNwrxxivttuipyqrcprocMOurnxvueyiirrruurqypqrqupuiiopotrquouiipirpyryrr|>rrr>poii|iiryqopoqtqqquryuyqoprreoruowiouiewiyrertqoyryeiyriwypoiypyieyiiiiiyppiiuteqie
Koncham fast ga episode release cheyandi
thankyou for watching andi.. content baga ravali ante gap ravatam normal. pls share video with your friends too..
Bro weekly one I plan cheyandi bro episode
thankyou for watching andi.. content baga ravali ante gap ravatam normal. pls share video with your friends too..
Next part bro
coming soon.. wait manchi content loading. thanks for watching
Chala gap vachhindhii bro, koddiga twaraga teeyochhu ga episode
thankyou for watching andi.. content baga ravali ante gap ravatam normal. pls share video with your friends too..
@@BaluMahendera okk
Plz fast ga next episode release cheyandi
vasthundi bro swigy zomato kadu kada. content thime padthundi. thankyou for watching andi.. pls share video with your friends too..
Very late episode 😔😭😅
Duel role bagundi 😅
continue continue 😅😅😅😅😅
thank you for watching..
Magalluu epudu adavalla dhagara yerrriiiiii pushpa le
Madhumita webseries Team, meeku mind panichestha ledha yendhi...
Ee series mottham serial laane delay chesthu vuntara....
Meeku konchamaina alochana vundha?
Week ki oka episode release cheyalani....
Ledante episodes la release cheyoddhu....
Okesari full movie release cheyandi choosi anandhistham
🙏
Episode, episode ki challa late avuthunde anduku tondaraga upload cheyachu kada
thank you for watching.. content baga ravali ante late avthundi bro
Super ,mee expression and dailougs. Kani voice sound Chala low lo vuntundi chudandi
Thank you for watching. keep up the volume on high for a better experience
Madam as early posiible release the nxt episode
Ok try chestam andi. Try to subscribe and share with your friends and family
@@BaluMahendera sure
Next episode vasundha asalu
thankyou for watching andi.. content baga ravali ante gap ravatam normal. pls share video with your friends too..
subscribe cheyinchandi bro
Episodes koncham fast ga release cheyandi babu
thankyou for watching andi.. content baga ravali ante gap ravatam normal. pls share video with your friends too..
@@BaluMahendera Cool. Em problem ledu. Please take your time and give us the best content like you are doing now 🤠
Balu Mahendra anna small suggestion: Konchem emotional touch and dailouges add cheyyu anna routine drama avutundhi. Emotional ante drink adhi kakunda emtional story develop cheyyandi.
From: Mamatha fans ikkada
Bro ani contents unai.. need to wait.. time batti vastai
Next episode eppudu iam waiting
thankyou for watching andi.. content baga ravali ante gap ravatam normal. pls share video with your friends too..subscribe cheyandi
Idoka series undi ani mik gurtu unda 😢marchipoyaru anukunna
Same
@@subhashrockstar8353 thankyou for watching andi.. content baga ravali ante gap ravatam normal. pls share video with your friends too..
Hello hai Andi next video Appudu Andi
Next week
Forth episode date
Next week
E series undani kudaa marchupothunna ento
thankyou for watching andi.. content baga ravali ante gap ravatam normal. pls share video with your friends too..
Ee saari next episode next month lo vasthunda 😂😂😂
Yenti bro entha gap echaru😢😢😢😢
manchi content ravali ante gap mukyam bigulu. thanks for watching
Ala ante yela bigulu😅😅😅 fans marachi potharu kada episodes bigulu 😂😂🎉🎉🎉
Anyway good webseries ❤❤❤
@@vijaykumarobilisetty8640 thanks for watching pls share with family and friends
Next episode eppudu?
vasthundi bro swigy zomato kadu kada. content thime padthundi. thankyou for watching andi.. pls share video with your friends too..
Play boy
ఇదేం ట్విస్ట్ ట్విస్టు రా బాబు మైండ్ బ్లోయింగ్
edi em twist mundhu mundhu pack avrtharu twistla tho.. repati kosam eroju like kotandi.